PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G26860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 251aa    MW: 28343.4 Da    PI: 7.5363
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G26860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ 
  LPERR03G26860.1  4 RGHWRPSEDEKLKELVARYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding54.42.9e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++T+eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  LPERR03G26860.1 56 RNPFTEEEEELLLASHRAHGNR-WAVIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.683154IPR017930Myb domain
SMARTSM007171.9E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-29497IPR009057Homeodomain-like
PfamPF002496.2E-18449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-27557IPR009057Homeodomain-like
CDDcd001674.98E-14748No hitNo description
SMARTSM007178.2E-1655103IPR001005SANT/Myb domain
PROSITE profilePS5129419.58155105IPR017930Myb domain
PfamPF002491.4E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2158104IPR009057Homeodomain-like
CDDcd001671.39E-57198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVA RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEELLLAS HRAHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERMR LSNRRVGGGT  120
ATGSSAAGAA KDESPRINNG DKTMTMTTRP DTNISSMAMA SLLDKYRREC GAAGLFAISS  180
HHNSKEDYCS STNEDTSKSV EFYDFLQVNA SSSDTKCGSS IEEQEDNRDD DQAEGQVQLI  240
DFMEVGTTSR Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-3411051105C-Myb DNA-Binding Domain
1msf_C3e-3411051105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1115601e-149AK111560.1 Oryza sativa Japonica Group cDNA clone:J013060F16, full insert sequence.
GenBankCT8327831e-149CT832783.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA045C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628938.11e-153PREDICTED: transcriptional activator Myb
TrEMBLA0A0D9VYB20.0A0A0D9VYB2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013472-PA1e-152(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-76myb domain protein 52